Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 proteins) C-terminal part of Pfam PF08715 |
Protein Papain-like protease PLpro, catalytic domain [310795] (4 species) |
Species SARS coronavirus [TaxId:227859] [311054] (1 PDB entry) |
Domain d2fe8b2: 2fe8 B:63-314 [303818] Other proteins in same PDB: d2fe8a1, d2fe8b1, d2fe8c1 complexed with br, so4, zn |
PDB Entry: 2fe8 (more details), 1.85 Å
SCOPe Domain Sequences for d2fe8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe8b2 d.3.1.23 (B:63-314) Papain-like protease PLpro, catalytic domain {SARS coronavirus [TaxId: 227859]} dtlrseafeyyhtldesflgrymsalnhtkkwkfpqvggltsikwadnncylssvllalq qlevkfnapalqeayyraragdaanfcalilaysnktvgelgdvretmthllqhanlesa krvlnvvckhcgqktttltgveavmymgtlsydnlktgvsipcvcgrdatqylvqqessf vmmsappaeyklqqgtflcaneytgnyqcghythitaketlyridgahltkmseykgpvt dvfyketsyttt
Timeline for d2fe8b2:
View in 3D Domains from other chains: (mouse over for more information) d2fe8a1, d2fe8a2, d2fe8c1, d2fe8c2 |