Lineage for d2dh0b2 (2dh0 B:74-175)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2727850Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
    multihelical; interlocked (homo)dimer
  4. 2727851Superfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) (S)
  5. 2727852Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins)
  6. 2728183Protein Transcriptional regulator Cgl2612 [140895] (1 species)
  7. 2728184Species Corynebacterium glutamicum [TaxId:1718] [140896] (5 PDB entries)
    Uniprot Q8NMG3 75-175
  8. 2728192Domain d2dh0b2: 2dh0 B:74-175 [303731]
    Other proteins in same PDB: d2dh0a1, d2dh0b1, d2dh0b3
    automated match to d2zoza2
    complexed with et, gol, so4

Details for d2dh0b2

PDB Entry: 2dh0 (more details), 1.95 Å

PDB Description: Crystal structure of the TetR-family protein CGL2612 from C.glutamicum bound to ethidium
PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2dh0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2dh0b2 a.121.1.1 (B:74-175) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
pedplerlravvvtlaenvsrpellllidapshpdflnawrtvnhqwipdtddlendahk
ravylvqlaadglfvhdyihddvlskskrqamletilelips

SCOPe Domain Coordinates for d2dh0b2:

Click to download the PDB-style file with coordinates for d2dh0b2.
(The format of our PDB-style files is described here.)

Timeline for d2dh0b2: