SCOPe 2.08: Domain d2dh0b1: 2dh0 B:1-73

Lineage for d2dh0b1 (2dh0 B:1-73)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (21 families)
   consists only of helices

5. Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)

6. Protein Transcriptional regulator Cgl2612 [140181] (1 species)

7. Species Corynebacterium glutamicum [TaxId:1718] [140182] (5 PDB entries)
   Uniprot Q8NMG3 1-174

8. Domain d2dh0b1: 2dh0 B:1-73 [303730]
   Other proteins in same PDB: d2dh0a2, d2dh0b2, d2dh0b3
   automated match to d2zoza1
   complexed with et, gol, so4

Details for d2dh0b1

PDB Entry: 2dh0, 1.95 Å

PDB Description: Crystal structure of the TetR-family protein CGL2612 from C.glutamicum bound to ethidium

PDB Compounds: (B:) Transcriptional regulator

SCOPe Domain Sequences for d2dh0b1:

Sequence; same for both SEQRES and ATOM records:

>d2dh0b1 a.4.1.9 (B:1-73) Transcriptional regulator Cgl2612 {Corynebacterium glutamicum [TaxId: 1718]}
mrtskkemilrtaidyigeysletlsydslaeatglsksgliyhfpsrhalllgmhella
ddwdkelrditrd

Timeline for d2dh0b1:

• d2dh0b1 first appeared in SCOPe 2.06
  
• d2dh0b1 appears in SCOPe 2.07