Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.1: double-SIS domain [53698] (5 proteins) duplication: consists of two SIS domains related by pseudo dyad |
Protein 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) [53699] (2 species) |
Species Escherichia coli [TaxId:562] [53700] (6 PDB entries) |
Domain d2bplc4: 2bpl C:241-608 [303604] Other proteins in same PDB: d2bpla3, d2bplb3, d2bplc3 automated match to d1jxaa1 complexed with f6r |
PDB Entry: 2bpl (more details), 2.05 Å
SCOPe Domain Sequences for d2bplc4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bplc4 c.80.1.1 (C:241-608) 'Isomerase domain' of glucosamine 6-phosphate synthase (GLMS) {Escherichia coli [TaxId: 562]} dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn laksvtve
Timeline for d2bplc4:
View in 3D Domains from other chains: (mouse over for more information) d2bpla3, d2bpla4, d2bplb3, d2bplb4 |