PDB entry 2bpl

View 2bpl on RCSB PDB site
Description: E coli GLUCOSAMINE-6P SYNTHASE IN COMPLEXE WITH FRUCTOSE-6P
Class: transferase
Keywords: amidotransferase, ammonia channeling, glucosamine 6-phosphate synthase, fructose 6-phosphate, n terminal nucleophile, glutamine amidotransferase, transferase
Deposited on 2005-04-20, released 2005-12-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2013-04-24, with a file datestamp of 2013-04-19.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.212
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOPe 2.08: d2bpla3, d2bpla4
  • Chain 'B':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOPe 2.08: d2bplb3, d2bplb4
  • Chain 'C':
    Compound: glucosamine--fructose-6-phosphate aminotransferase [isomerizing]
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17169 (0-607)
      • conflict (420)
    Domains in SCOPe 2.08: d2bplc3, d2bplc4
  • Heterogens: F6R, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bplA (A:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bplB (B:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bplC (C:)
    cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
    hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
    etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
    glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
    dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
    gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
    lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
    klkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
    egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
    gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
    laksvtve