SCOPe 2.08: Domain d2bgxa4: 2bgx A:180-260

Lineage for d2bgxa4 (2bgx A:180-260)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.20: PGBD-like [47089] (1 superfamily)
   core: 3 helices; bundle, closed, left-handed twist; parallel

4. Superfamily a.20.1: PGBD-like [47090] (3 families)

5. Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins)

6. Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species)

7. Species Escherichia coli [TaxId:562] [140391] (3 PDB entries)
   Uniprot P75820 195-275

8. Domain d2bgxa4: 2bgx A:180-260 [303580]
   Other proteins in same PDB: d2bgxa3
   automated match to d2wkxa1
   complexed with zn

Details for d2bgxa4

PDB Entry: 2bgx, 1.8 Å

PDB Description: crystal structure of native amid at 1.8 angstrom

PDB Compounds: (A:) n-acetylmuramoyl-l-alanine amidase

SCOPe Domain Sequences for d2bgxa4:

Sequence; same for both SEQRES and ATOM records:

>d2bgxa4 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]}
pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly
ngeadaetqaiaeallekygq

Timeline for d2bgxa4:

• d2bgxa4 first appeared in SCOPe 2.06
  
• d2bgxa4 appears in SCOPe 2.07