![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.20: PGBD-like [47089] (1 superfamily) core: 3 helices; bundle, closed, left-handed twist; parallel |
![]() | Superfamily a.20.1: PGBD-like [47090] (3 families) ![]() |
![]() | Family a.20.1.1: Peptidoglycan binding domain, PGBD [47091] (2 proteins) |
![]() | Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain [140390] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [140391] (3 PDB entries) Uniprot P75820 195-275 |
![]() | Domain d2bgxa4: 2bgx A:180-260 [303580] Other proteins in same PDB: d2bgxa3 automated match to d2wkxa1 complexed with zn |
PDB Entry: 2bgx (more details), 1.8 Å
SCOPe Domain Sequences for d2bgxa4:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgxa4 a.20.1.1 (A:180-260) Probable N-acetylmuramoyl-L-alanine amidase YbjR, C-terminal domain {Escherichia coli [TaxId: 562]} pdaqrvnfylagraphtpvdtasllellarygydvkpdmtpreqrrvimafqmhfrptly ngeadaetqaiaeallekygq
Timeline for d2bgxa4: