![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.118: N-acetylmuramoyl-L-alanine amidase-like [55845] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.118.1: N-acetylmuramoyl-L-alanine amidase-like [55846] (2 families) ![]() |
![]() | Family d.118.1.1: N-acetylmuramoyl-L-alanine amidase-like [55847] (11 proteins) Family 2 zinc amidase; |
![]() | Protein Probable N-acetylmuramoyl-L-alanine amidase YbjR, N-terminal domain [143782] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [143783] (3 PDB entries) Uniprot P75820 22-194 |
![]() | Domain d2bgxa3: 2bgx A:7-179 [303579] Other proteins in same PDB: d2bgxa4 automated match to d2wkxa2 complexed with zn |
PDB Entry: 2bgx (more details), 1.8 Å
SCOPe Domain Sequences for d2bgxa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bgxa3 d.118.1.1 (A:7-179) Probable N-acetylmuramoyl-L-alanine amidase YbjR, N-terminal domain {Escherichia coli [TaxId: 562]} givekegyqldtrrqaqaayprikvlvihytaddfdsslatltdkqvsshylvpavppry ngkpriwqlvpeqelawhagisawrgatrlndtsigielenrgwqksagvkyfapfepaq iqaliplakdiiaryhikpenvvahadiapqrkddpgplfpwqqlaqqgigaw
Timeline for d2bgxa3: