Lineage for d2a23a1 (2a23 A:414-487)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2642549Fold g.50: FYVE/PHD zinc finger [57902] (2 superfamilies)
    dimetal(zinc)-bound alpha+beta fold
  4. 2642550Superfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) (S)
  5. 2642573Family g.50.1.2: PHD domain [57911] (14 proteins)
  6. 2642615Protein V(D)J recombination-activating protein 2, Rag2 [161224] (1 species)
  7. 2642616Species Mouse (Mus musculus) [TaxId:10090] [161225] (2 PDB entries)
    Uniprot P21784 414-487
  8. 2642617Domain d2a23a1: 2a23 A:414-487 [303498]
    Other proteins in same PDB: d2a23a2
    automated match to d2v85b_
    complexed with zn

Details for d2a23a1

PDB Entry: 2a23 (more details)

PDB Description: A PHD finger motif in the c-terminus of rag2 modulates recombination activity
PDB Compounds: (A:) V(D)J recombination activating protein 2

SCOPe Domain Sequences for d2a23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a23a1 g.50.1.2 (A:414-487) V(D)J recombination-activating protein 2, Rag2 {Mouse (Mus musculus) [TaxId: 10090]}
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara

SCOPe Domain Coordinates for d2a23a1:

Click to download the PDB-style file with coordinates for d2a23a1.
(The format of our PDB-style files is described here.)

Timeline for d2a23a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a23a2