Lineage for d2v85b_ (2v85 B:)
- Root: SCOPe 2.05
Class g: Small proteins [56992] (92 folds) 
Fold g.50: FYVE/PHD zinc finger [57902] (1 superfamily)
dimetal(zinc)-bound alpha+beta foldSuperfamily g.50.1: FYVE/PHD zinc finger [57903] (4 families) 
Family g.50.1.2: PHD domain [57911] (14 proteins) Protein automated matches [190654] (2 species)
not a true proteinSpecies Mouse (Mus musculus) [TaxId:10090] [187735] (7 PDB entries) 
Domain d2v85b_: 2v85 B: [152771]
automated match to d2jwoa1
protein/DNA complex; complexed with zn
Details for d2v85b_
PDB Entry: 2v85 (more details), 2 Å
PDB Description: crystal structure of rag2-phd finger in complex with h3r2me1k4me3 peptide
PDB Compounds: (B:) vdj recombination-activating protein 2SCOPe Domain Sequences for d2v85b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2v85b_ g.50.1.2 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
lihlsegsnkyycnehvqiara
SCOPe Domain Coordinates for d2v85b_:
Click to download the PDB-style file with coordinates for d2v85b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2v85b_:
- d2v85b_ first appeared in SCOP 1.75, called d2v85b1
- d2v85b_ appears in SCOPe 2.04
- d2v85b_ is called d2v85b2 in SCOPe 2.06
- d2v85b_ appears in the current release, SCOPe 2.08, called d2v85b2
View in 3D
