PDB entry 2v85
View 2v85 on RCSB PDB site
Description: crystal structure of rag2-phd finger in complex with h3r2me1k4me3 peptide
Class: protein binding
Keywords: v(d)j recombination, covalent modifications, rag2, histone, nucleus, nuclease, hydrolase, phd finger, DNA-binding, recombinase, endonuclease, trimethyl lysine, DNA recombination, protein binding
Deposited on
2007-08-02, released
2007-12-11
The last revision prior to the SCOPe 2.05 freeze date was dated
2009-11-03, with a file datestamp of
2009-10-30.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.1866
AEROSPACI score: 0.45
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: vdj recombination-activating protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- PDB 2V85
- Uniprot P21784 (8-81)
Domains in SCOPe 2.05: d2v85a_ - Chain 'B':
Compound: vdj recombination-activating protein 2
Species: Mus musculus [TaxId:10090]
Database cross-references and differences (RAF-indexed):
- PDB 2V85 (0-7)
- Uniprot P21784 (8-81)
Domains in SCOPe 2.05: d2v85b_ - Chain 'D':
Compound: h3r2me1k4me3 peptide
Database cross-references and differences (RAF-indexed):
- Chain 'E':
Compound: h3r2me1k4me3 peptide
Database cross-references and differences (RAF-indexed):
- Heterogens: ZN, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence, based on SEQRES records: (download)
>2v85A (A:)
gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
lihlsegsnkyycnehvqiara
Sequence, based on observed residues (ATOM records): (download)
>2v85A (A:)
gywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleertlihlsegs
nkyycnehvqiara
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>2v85B (B:)
gplgspefgywitccptcdvdintwvpfystelnkpamiycshgdghwvhaqcmdleert
lihlsegsnkyycnehvqiara
- Chain 'D':
No sequence available.
- Chain 'E':
No sequence available.