Lineage for d1yawa1 (1yaw A:1-137)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566869Superfamily d.79.4: PurM N-terminal domain-like [55326] (2 families) (S)
  5. 2566870Family d.79.4.1: PurM N-terminal domain-like [55327] (7 proteins)
  6. 2566948Protein automated matches [227043] (2 species)
    not a true protein
  7. 2566949Species Aquifex aeolicus [311194] (1 PDB entry)
  8. 2566950Domain d1yawa1: 1yaw A:1-137 [303384]
    Other proteins in same PDB: d1yawa2, d1yawb2
    automated match to d3c9ua1
    complexed with po4

Details for d1yawa1

PDB Entry: 1yaw (more details), 2.65 Å

PDB Description: Crystal structure of thiamine monophosphate kinase (thiL) from Aquifex aeolicus
PDB Compounds: (A:) Thiamine monophosphate kinase

SCOPe Domain Sequences for d1yawa1:

Sequence, based on SEQRES records: (download)

>d1yawa1 d.79.4.1 (A:1-137) automated matches {Aquifex aeolicus}
mrlkelaefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
sksekigisvflvgete

Sequence, based on observed residues (ATOM records): (download)

>d1yawa1 d.79.4.1 (A:1-137) automated matches {Aquifex aeolicus}
mrlkelglidlikktleskviddtapvskklllttdvlnegvhflrsyipeavgwkaisv
nvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekig
isvflvgete

SCOPe Domain Coordinates for d1yawa1:

Click to download the PDB-style file with coordinates for d1yawa1.
(The format of our PDB-style files is described here.)

Timeline for d1yawa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yawa2