Lineage for d1wb2c5 (1wb2 C:1-179)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128876Species Methanococcus maripaludis [TaxId:39152] [226757] (5 PDB entries)
  8. 2128886Domain d1wb2c5: 1wb2 C:1-179 [303285]
    Other proteins in same PDB: d1wb2a6, d1wb2a7, d1wb2a8, d1wb2a9, d1wb2b5, d1wb2b6, d1wb2c6, d1wb2c7, d1wb2c8, d1wb2c9, d1wb2d5, d1wb2d6
    automated match to d4ac9a4
    complexed with dxc, so4

Details for d1wb2c5

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form
PDB Compounds: (C:) translation elongation factor selb

SCOPe Domain Sequences for d1wb2c5:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wb2c5 c.37.1.0 (C:1-179) automated matches {Methanococcus maripaludis [TaxId: 39152]}
mdfkninlgifghidhgkttlskvlteiastsahdklpesqkrgitidigfsafklenyr
itlvdapghadliravvsaadiidlalivvdakegpktqtgehmlildhfnipiivvitk
sdnagteeikrtemimksilqsthnlknssiipisaktgfgvdelknliittlnnaeii

SCOPe Domain Coordinates for d1wb2c5:

Click to download the PDB-style file with coordinates for d1wb2c5.
(The format of our PDB-style files is described here.)

Timeline for d1wb2c5: