Lineage for d1wb2d6 (1wb2 D:272-388)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2063485Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2063486Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 2063593Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 2063594Protein automated matches [254425] (16 species)
    not a true protein
  7. 2063627Species Methanococcus maripaludis [TaxId:39152] [311185] (2 PDB entries)
  8. 2063635Domain d1wb2d6: 1wb2 D:272-388 [303292]
    Other proteins in same PDB: d1wb2a5, d1wb2a6, d1wb2a8, d1wb2a9, d1wb2b4, d1wb2b5, d1wb2c5, d1wb2c6, d1wb2c8, d1wb2c9, d1wb2d4, d1wb2d5
    automated match to d4ac9a3
    complexed with dxc, so4

Details for d1wb2d6

PDB Entry: 1wb2 (more details), 3.1 Å

PDB Description: Crystal structure of translation elongation factor SelB from Methanococcus maripaludis, apo form
PDB Compounds: (D:) translation elongation factor selb

SCOPe Domain Sequences for d1wb2d6:

Sequence, based on SEQRES records: (download)

>d1wb2d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkvtfgkteeniilne
visgnecycafeleekvlaevgdrvlitrldlppttlricghglieefkpikdlnik

Sequence, based on observed residues (ATOM records): (download)

>d1wb2d6 b.44.1.0 (D:272-388) automated matches {Methanococcus maripaludis [TaxId: 39152]}
klqtvdkivakikisdifkynltpkmkvhlnvgmlivpavavpfkkeniinecycafele
ekvlaevgdrvlitrldlppttlricghglieefkpikdlnik

SCOPe Domain Coordinates for d1wb2d6:

Click to download the PDB-style file with coordinates for d1wb2d6.
(The format of our PDB-style files is described here.)

Timeline for d1wb2d6: