| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.19: Glycosyl hydrolases family 32 C-terminal domain [101652] (2 proteins) Pfam PF08244 flat sheet beta-sandwich lacking the characteristic beta-bulge in the C-terminal strand |
| Protein Beta-fructosidase (invertase), C-terminal domain [101653] (1 species) |
| Species Thermotoga maritima [TaxId:2336] [101654] (2 PDB entries) |
| Domain d1utwb2: 1utw B:295-432 [303164] Other proteins in same PDB: d1utwa1, d1utwb1, d1utwc1, d1utwd1, d1utwe1, d1utwf1 automated match to d1uypa1 complexed with cit, gol, na, so4 |
PDB Entry: 1utw (more details), 1.9 Å
SCOPe Domain Sequences for d1utwb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1utwb2 b.29.1.19 (B:295-432) Beta-fructosidase (invertase), C-terminal domain {Thermotoga maritima [TaxId: 2336]}
vdellalrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdel
ivdttrsgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynils
vksnqvklevfeleniwl
Timeline for d1utwb2: