PDB entry 1utw

View 1utw on RCSB PDB site
Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
Class: hydrolase
Keywords: hydrolase, glycosyl hydrolase family 32, sucrose degradation, beta-propeller, invertase
Deposited on 2003-12-11, released 2004-02-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2004-03-22, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.169
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwa1, d1utwa2
  • Chain 'B':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwb1, d1utwb2
  • Chain 'C':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwc1, d1utwc2
  • Chain 'D':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwd1, d1utwd2
  • Chain 'E':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwe1, d1utwe2
  • Chain 'F':
    Compound: beta-fructosidase
    Species: Thermotoga maritima
    Database cross-references and differences (RAF-indexed):
    • Uniprot O33833 (0-431)
      • conflict (0)
      • conflict (107)
      • conflict (178)
    Domains in SCOPe 2.07: d1utwf1, d1utwf2
  • Heterogens: SO4, NA, CIT, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwA (A:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwB (B:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwC (C:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwD (D:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwE (E:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1utwF (F:)
    lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
    pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
    gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
    fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
    aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkpvdella
    lrkrkvfetaksgtflldvkensyeivcefsgeielrmgneseevvitksrdelivdttr
    sgvsggevrkstvedeatnrirafldscsvefffndsiafsfrihpenvynilsvksnqv
    klevfeleniwl