Lineage for d1utwe1 (1utw E:1-294)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2064801Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2064807Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2064894Family b.67.2.3: Glycosyl hydrolases family 32 N-terminal domain [101884] (3 protein domains)
    Pfam PF00251; Glycosyl hydrolase family 32
  6. 2064895Protein Beta-fructosidase (invertase), N-terminal domain [101885] (1 species)
  7. 2064896Species Thermotoga maritima [TaxId:2336] [101886] (2 PDB entries)
  8. 2064901Domain d1utwe1: 1utw E:1-294 [303169]
    Other proteins in same PDB: d1utwa2, d1utwb2, d1utwc2, d1utwd2, d1utwe2, d1utwf2
    automated match to d1uypa2
    complexed with cit, gol, na, so4

Details for d1utwe1

PDB Entry: 1utw (more details), 1.9 Å

PDB Description: the three-dimensional structure of beta-fructosidase (invertase) from thermotoga maritima
PDB Compounds: (E:) beta-fructosidase

SCOPe Domain Sequences for d1utwe1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1utwe1 b.67.2.3 (E:1-294) Beta-fructosidase (invertase), N-terminal domain {Thermotoga maritima [TaxId: 2336]}
lfkpnyhffpitgwmndpnglifwkgkyhmfyqynprkpewgnicwghavsddlvhwrhl
pvalypddethgvfsgsavekdgkmflvytyyrdpthnkgeketqcvvmsengldfvkyd
gnpviskppeegthafrdpkvnrsngewrmvlgsgkdekigrvllytsddlfhwkyegai
fedettkeiecpdlvrigekdiliysitstnsvlfsmgelkegklnvekrglldhgtdfy
aaqtffgtdrvvvigwlqswlrtglyptkregwngvmslprelyvennelkvkp

SCOPe Domain Coordinates for d1utwe1:

Click to download the PDB-style file with coordinates for d1utwe1.
(The format of our PDB-style files is described here.)

Timeline for d1utwe1:

  • d1utwe1 is new in SCOPe 2.06-stable