Lineage for d1taxa_ (1tax A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2094316Protein automated matches [190057] (26 species)
    not a true protein
  7. 2094451Species Thermoascus aurantiacus [TaxId:5087] [190006] (5 PDB entries)
  8. 2094454Domain d1taxa_: 1tax A: [303078]
    automated match to d2bnja1

Details for d1taxa_

PDB Entry: 1tax (more details), 1.14 Å

PDB Description: thermostable xylanase i from thermoascus aurantiacus
PDB Compounds: (A:) protein (endo-1,4-beta-xylanase)

SCOPe Domain Sequences for d1taxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1taxa_ c.1.8.3 (A:) automated matches {Thermoascus aurantiacus [TaxId: 5087]}
asaqsvdqlikargkvyfgvatdqnrlttgknaaiiqanfgqvtpensmkwdatepsqgn
fnfagadylvnwaqqngklirghtlvwhsqlpswvtsitdkntltnvmknhittlmtryk
gkirawdvvneafnqngslrstvflnvigedyipiafqtaraadpnaklyindynldsat
ypktqaivnrvkqwraagvpidgigsqthlsagqgagvlnalpllasagtpevaiteldv
agasptdyvnvvnaclnvsscvgitvwgvadpdswrasttpllfdgnfnpkpaynaivqn
lq

SCOPe Domain Coordinates for d1taxa_:

Click to download the PDB-style file with coordinates for d1taxa_.
(The format of our PDB-style files is described here.)

Timeline for d1taxa_: