SCOPe 2.07: Domain d1qmma3: 1qmm A:525-725

Lineage for d1qmma3 (1qmm A:525-725)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.1: ARM repeat [48371] (27 families)

5. Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
   automatically mapped to Pfam PF00613
   this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain

6. Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [48401] (6 PDB entries)

8. Domain d1qmma3: 1qmm A:525-725 [302957]
   Other proteins in same PDB: d1qmma1, d1qmma2, d1qmma4, d1qmma5
   automated match to d1e8xa1
   complexed with atp, lu

Details for d1qmma3

PDB Entry: 1qmm, 2.2 Å

PDB Description: structural insights into phoshoinositide 3-kinase enzymatic mechanism and signalling

PDB Compounds: (A:) phosphatidylinositol 3-kinase catalytic subunit

SCOPe Domain Sequences for d1qmma3:

Sequence, based on SEQRES records:

>d1qmma3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialpkhrptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslk
dpkaypklfssvkwgqqeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraia
vqklesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseia
qsrhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records):

>d1qmma3 a.118.1.6 (A:525-725) Phoshoinositide 3-kinase (PI3K) helical domain {Pig (Sus scrofa) [TaxId: 9823]}
hpialempnqlrkqleaiiatdplnpltaedkellwhfryeslkdpkaypklfssvkwgq
qeivaktyqllakrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddvlhyl
lqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavileay
lrgcg

Timeline for d1qmma3:

• d1qmma3 first appeared in SCOPe 2.06
  
• d1qmma3 appears in the current release, SCOPe 2.08