Class a: All alpha proteins [46456] (289 folds) |
Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
Superfamily a.1.2: alpha-helical ferredoxin [46548] (3 families) contains two Fe4-S4 clusters |
Family a.1.2.1: Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain [46549] (3 proteins) |
Protein Fumarate reductase [46550] (3 species) |
Species Wolinella succinogenes [TaxId:844] [46552] (5 PDB entries) |
Domain d1qlab4: 1qla B:107-239 [302946] Other proteins in same PDB: d1qlaa4, d1qlaa5, d1qlaa6, d1qlab3, d1qlac_, d1qlad4, d1qlad5, d1qlad6, d1qlae3, d1qlaf_ automated match to d1qlbb1 complexed with ca, f3s, fad, fes, hem, lmt, sf4 |
PDB Entry: 1qla (more details), 2.2 Å
SCOPe Domain Sequences for d1qlab4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qlab4 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} tgnwfngmsqrveswihaqkehdiskleeriepevaqevfeldrciecgcciaacgtkim redfvgaaglnrvvrfmidphdertdedyyeligdddgvfgcmtllachdvcpknlplqs kiaylrrkmvsvn
Timeline for d1qlab4: