SCOPe 2.07: Domain d1qlaf_: 1qla F:

Lineage for d1qlaf_ (1qla F:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.2: Fumarate reductase respiratory complex transmembrane subunits [81343] (2 families)
   two distinct families: in one family the common fold is contained in a single-chain subunit, in the other it is formed by two chains

5. Family f.21.2.1: Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56910] (2 proteins)
   duplication: consists of two structural repeats; the heme-binding sites are related by pseudo two fold symmetry

6. Protein Fumarate reductase respiratory complex cytochrome b subunit, FrdC [56911] (1 species)

7. Species Wolinella succinogenes [TaxId:844] [56913] (5 PDB entries)

8. Domain d1qlaf_: 1qla F: [302953]
   Other proteins in same PDB: d1qlaa4, d1qlaa5, d1qlaa6, d1qlab3, d1qlab4, d1qlad4, d1qlad5, d1qlad6, d1qlae3, d1qlae4
   automated match to d1qlbc_
   complexed with ca, f3s, fad, fes, hem, lmt, sf4

Details for d1qlaf_

PDB Entry: 1qla, 2.2 Å

PDB Description: respiratory complex ii-like fumarate reductase from wolinella succinogenes

PDB Compounds: (F:) fumarate reductase cytochrome b subunit

SCOPe Domain Sequences for d1qlaf_:

Sequence; same for both SEQRES and ATOM records:

>d1qlaf_ f.21.2.1 (F:) Fumarate reductase respiratory complex cytochrome b subunit, FrdC {Wolinella succinogenes [TaxId: 844]}
mtnesilesysgvtperkksrmpakldwwqsatglflglfmighmffvstillgdnvmlw
vtkkfeldfifeggkpivvsflaafvfavfiahaflamrkfpinyrqyltfkthkdlmrh
gdttlwwiqamtgfamfflgsvhlyimmtqpqtigpvsssfrmvsewmwplylvllfave
lhgsvglyrlavkwgwfdgetpdktranlkklktlmsaflivlglltfgayvkkgleqtd
pnidykyfdykrth

Timeline for d1qlaf_:

• d1qlaf_ first appeared in SCOPe 2.06
  
• d1qlaf_ appears in the current release, SCOPe 2.08