SCOP 1.71: Domain d1qr6b1: 1qr6 B:1280-1573

Lineage for d1qr6b1 (1qr6 B:1280-1573)

1. Root: SCOP 1.71

2. Class c: Alpha and beta proteins (a/b) [51349] (134 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (11 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
   includes C-terminal additional subdomains

7. Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)

8. Domain d1qr6b1: 1qr6 B:1280-1573 [30294]
   Other proteins in same PDB: d1qr6a2, d1qr6b2
   complexed with nad; mutant

Details for d1qr6b1

PDB Entry: 1qr6, 2.1 Å

PDB Description: human mitochondrial nad(p)-dependent malic enzyme

SCOP Domain Sequences for d1qr6b1:

Sequence; same for both SEQRES and ATOM records:

>d1qr6b1 c.2.1.7 (B:1280-1573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

Timeline for d1qr6b1:

• d1qr6b1 first appeared (with stable ids) in SCOP 1.55
  
• d1qr6b1 appears in SCOP 1.69
  
• d1qr6b1 appears in SCOP 1.73
  
• d1qr6b1 appears in the current release, SCOPe 2.08