Lineage for d1qr6b1 (1qr6 B:1280-1573)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845190Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2845344Protein Mitochondrial NAD(P)-dependent malic enzyme [51898] (3 species)
    includes C-terminal additional subdomains
  7. 2845362Species Human (Homo sapiens) [TaxId:9606] [51899] (10 PDB entries)
  8. 2845376Domain d1qr6b1: 1qr6 B:1280-1573 [30294]
    Other proteins in same PDB: d1qr6a2, d1qr6b2
    complexed with nad
    has additional subdomain(s) that are not in the common domain

Details for d1qr6b1

PDB Entry: 1qr6 (more details), 2.1 Å

PDB Description: human mitochondrial nad(p)-dependent malic enzyme
PDB Compounds: (B:) malic enzyme 2

SCOPe Domain Sequences for d1qr6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qr6b1 c.2.1.7 (B:1280-1573) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens) [TaxId: 9606]}
iqgtaavalagllaaqkviskpisehkilflgageaalgianlivmsmvenglseqeaqk
kiwmfdkygllvkgrkakidsyqepfthsapesipdtfedavnilkpstiigvagagrlf
tpdviramasinerpvifalsnptaqaectaeeaytltegrclfasgspfgpvkltdgrv
ftpgqgnnvyifpgvalavilcntrhisdsvfleaakaltsqltdeelaqgrlypplani
qevsiniaikvteylyankmafrypepedkakyvkertwrseydsllpdvyewp

SCOPe Domain Coordinates for d1qr6b1:

Click to download the PDB-style file with coordinates for d1qr6b1.
(The format of our PDB-style files is described here.)

Timeline for d1qr6b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qr6b2