Lineage for d1pb6c3 (1pb6 C:14-85)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2305222Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2305223Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 2305653Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2305714Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 2305715Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)
  8. 2305720Domain d1pb6c3: 1pb6 C:14-85 [302888]
    Other proteins in same PDB: d1pb6a4, d1pb6b4, d1pb6c4, d1pb6d4
    automated match to d3loca1

Details for d1pb6c3

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC
PDB Compounds: (C:) Hypothetical transcriptional regulator ycdC

SCOPe Domain Sequences for d1pb6c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6c3 a.4.1.9 (C:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre

SCOPe Domain Coordinates for d1pb6c3:

Click to download the PDB-style file with coordinates for d1pb6c3.
(The format of our PDB-style files is described here.)

Timeline for d1pb6c3: