Lineage for d1pb6c3 (1pb6 C:14-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692210Family a.4.1.9: Tetracyclin repressor-like, N-terminal domain [46764] (35 proteins)
  6. 2692271Protein Hypothetical transcriptional regulator YcdC [88973] (1 species)
  7. 2692272Species Escherichia coli [TaxId:562] [88974] (4 PDB entries)
  8. 2692281Domain d1pb6c3: 1pb6 C:14-85 [302888]
    Other proteins in same PDB: d1pb6a4, d1pb6b4, d1pb6c4, d1pb6d4
    automated match to d3loca1

Details for d1pb6c3

PDB Entry: 1pb6 (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical transcriptional regulator ycdC
PDB Compounds: (C:) Hypothetical transcriptional regulator ycdC

SCOPe Domain Sequences for d1pb6c3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pb6c3 a.4.1.9 (C:14-85) Hypothetical transcriptional regulator YcdC {Escherichia coli [TaxId: 562]}
avsakkkailsaaldtfsqfgfhgtrleqiaelagvsktnllyyfpskealyiavlrqil
diwlaplkafre

SCOPe Domain Coordinates for d1pb6c3:

Click to download the PDB-style file with coordinates for d1pb6c3.
(The format of our PDB-style files is described here.)

Timeline for d1pb6c3: