Lineage for d1oama2 (1oam A:298-394)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2038571Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2038954Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)
  6. 2038955Protein Envelope glycoprotein [49213] (5 species)
  7. 2038956Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
    Uniprot P12823 281-675 # 99% sequence identity
  8. 2038958Domain d1oama2: 1oam A:298-394 [302814]
    Other proteins in same PDB: d1oama1, d1oamb1
    automated match to d1ok8a1
    complexed with bgl, nag

Details for d1oama2

PDB Entry: 1oam (more details), 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside
PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1oama2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oama2 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

SCOPe Domain Coordinates for d1oama2:

Click to download the PDB-style file with coordinates for d1oama2.
(The format of our PDB-style files is described here.)

Timeline for d1oama2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1oama1