SCOPe 2.08: Domain d1oama2: 1oam A:298-394

Lineage for d1oama2 (1oam A:298-394)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.18: E set domains [81296] (27 families)
   "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies

5. Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins)

6. Protein Envelope glycoprotein [49213] (5 species)

7. Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries)
   Uniprot P12823 281-675 # 99% sequence identity

8. Domain d1oama2: 1oam A:298-394 [302814]
   Other proteins in same PDB: d1oama1, d1oamb1
   automated match to d1ok8a1
   complexed with bgl, nag

Details for d1oama2

PDB Entry: 1oam, 2.4 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein in complex with n-octyl-beta-d-glucoside

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1oama2:

Sequence; same for both SEQRES and ATOM records:

>d1oama2 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk

Timeline for d1oama2:

• d1oama2 first appeared in SCOPe 2.06
  
• d1oama2 appears in SCOPe 2.07