| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.4: Class II viral fusion proteins C-terminal domain [81284] (3 proteins) |
| Protein Envelope glycoprotein [49213] (5 species) |
| Species Dengue virus type 2 [TaxId:11060] [89194] (10 PDB entries) Uniprot P12823 281-675 # 99% sequence identity |
| Domain d1oama2: 1oam A:298-394 [302814] Other proteins in same PDB: d1oama1, d1oamb1 automated match to d1ok8a1 complexed with bgl, nag |
PDB Entry: 1oam (more details), 2.4 Å
SCOPe Domain Sequences for d1oama2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1oama2 b.1.18.4 (A:298-394) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
sysmctgkfkvvkeiaetqhgtivirvqyegdgspckipfeimdlekrhvlgrlitvnpi
vtekdspvnieaeppfgdsyiiigvepgqlklnwfkk
Timeline for d1oama2: