Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins) automatically mapped to Pfam PF07876 |
Protein Hypothetical protein AT3G17210.1 [89928] (1 species) |
Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (4 PDB entries) |
Domain d1nwja1: 1nwj A:4-112 [302787] Other proteins in same PDB: d1nwja2 automated match to d1q53a_ |
PDB Entry: 1nwj (more details)
SCOPe Domain Sequences for d1nwja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwja1 d.58.4.4 (A:4-112) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} meeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgy thifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl
Timeline for d1nwja1: