SCOPe 2.08: Domain d1nwja1: 1nwj A:4-112

Lineage for d1nwja1 (1nwj A:4-112)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.4: Plant stress-induced protein [89927] (3 proteins)
   automatically mapped to Pfam PF07876

6. Protein Hypothetical protein AT3G17210.1 [89928] (1 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [89929] (4 PDB entries)

8. Domain d1nwja1: 1nwj A:4-112 [302787]
   Other proteins in same PDB: d1nwja2
   automated match to d1q53a_

Details for d1nwja1

PDB Entry: 1nwj

PDB Description: solution structure of hypothetical arabidopsis thaliana protein at3g17210. center for eukaryotic structural genomics target 13081

PDB Compounds: (A:) expressed protein: At3g17210.1

SCOPe Domain Sequences for d1nwja1:

Sequence; same for both SEQRES and ATOM records:

>d1nwja1 d.58.4.4 (A:4-112) Hypothetical protein AT3G17210.1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
meeakgpvkhvllasfkdgvspekieelikgyanlvnliepmkafhwgkdvsienlhqgy
thifestfeskeavaeyiahpahvefatiflgsldkvlvidykptsvsl

Timeline for d1nwja1:

• d1nwja1 first appeared in SCOPe 2.06
  
• d1nwja1 appears in SCOPe 2.07