Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.49: Pyruvate kinase C-terminal domain-like [52934] (2 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145, strand 5 is antiparallel to the rest |
Superfamily c.49.1: PK C-terminal domain-like [52935] (2 families) |
Family c.49.1.1: Pyruvate kinase, C-terminal domain [52936] (1 protein) automatically mapped to Pfam PF02887 |
Protein Pyruvate kinase, C-terminal domain [52937] (6 species) |
Species Human (Homo sapiens) [TaxId:9606] [82431] (8 PDB entries) |
Domain d1lixc6: 1lix C:440-573 [302700] Other proteins in same PDB: d1lixa4, d1lixa5, d1lixb4, d1lixc4, d1lixc5, d1lixd4, d1lixd5 automated match to d2vgia3 complexed with fbp, k, mn, pga; mutant |
PDB Entry: 1lix (more details), 2.87 Å
SCOPe Domain Sequences for d1lixc6:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lixc6 c.49.1.1 (C:440-573) Pyruvate kinase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} elrraaplsrdptevtaigaveaafkccaaaiivltttgrsaqllswyrpraaviavtrs aqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesgklrgflrvgdlvivvtgwr pgsgytnimrvlsi
Timeline for d1lixc6: