PDB entry 1lix

View 1lix on RCSB PDB site
Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
Class: transferase
Keywords: nonspherocytic hemolytic anemia, erythrocyte, TRANSFERASE
Deposited on 2002-04-18, released 2002-09-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2007-11-20, with a file datestamp of 2007-11-16.
Experiment type: XRAY
Resolution: 2.87 Å
R-factor: 0.245
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered (439)
    Domains in SCOPe 2.07: d1lixa4, d1lixa5, d1lixa6
  • Chain 'B':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered (439)
    Domains in SCOPe 2.07: d1lixb4, d1lixb5
  • Chain 'C':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered (439)
    Domains in SCOPe 2.07: d1lixc4, d1lixc5, d1lixc6
  • Chain 'D':
    Compound: Pyruvate kinase, isozymes R/L
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P30613
      • engineered (439)
    Domains in SCOPe 2.07: d1lixd4, d1lixd5, d1lixd6
  • Heterogens: FBP, PGA, K, MN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lixA (A:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixA (A:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaa
    vraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmm
    igrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpve
    avkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltt
    tgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfg
    iesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lixB (B:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixB (B:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgivlvtantvdy
    pniviyiddglislvvvtvenggvkgvnlplpglseqdvrdlrfgvehgvdivfasfvrk
    asdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvf
    laqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetak
    gnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaa
    iivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvd
    rrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lixC (C:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixC (C:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilqggpeseve
    lvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpegl
    vtqvenggvlgsrkgvnlpgadlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavr
    aalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmig
    rcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveav
    kmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttg
    rsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgie
    sgklrgflrvgdlvivvtgwrpgsgytnimrvlsi
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lixD (D:)
    ltqelgtaffqqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlke
    mikagmniarlnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgi
    lqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglisl
    vvqkigpeglvtqvenggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfas
    fvrkasdvaavraalgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipa
    ekvflaqkmmigrcnlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsg
    etakgnfpveavkmqhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkc
    caaaiivltttgrsaqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwa
    ddvdrrvqfgiesgklrgflrvgdlvivvtgwrpgsgytnimrvlsis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lixD (D:)
    qqqqlpaamadtflehlclldidsepvaarstsiiatigpasrsverlkemikagmniar
    lnfshgsheyhaesianvreavesfagsplsyrpvaialdtkgpeirtgilesevelvkg
    sqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyiddglislvvqkigpeglvtqv
    enggvlgsrkgvnlpgaqvdlpglseqdvrdlrfgvehgvdivfasfvrkasdvaavraa
    lgpeghgikiiskienhegvkrfdeilevsdgimvargdlgieipaekvflaqkmmigrc
    nlagkpvvcatqmlesmitkprptraetsdvanavldgadcimlsgetakgnfpveavkm
    qhaiareaeaavyhrqlfeelrraaplsrdptevtaigaveaafkccaaaiivltttgrs
    aqllswyrpraaviavtrsaqaarqvhlcrgvfpllyreppeaiwaddvdrrvqfgiesg
    klrgflrvgdlvivvtgwrpgsgytnimrvlsi