Lineage for d1lixc5 (1lix C:160-261)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2804062Fold b.58: PK beta-barrel domain-like [50799] (1 superfamily)
    barrel, closed; n=7, S=10; complex topology
  4. 2804063Superfamily b.58.1: PK beta-barrel domain-like [50800] (2 families) (S)
  5. 2804064Family b.58.1.1: Pyruvate kinase beta-barrel domain [50801] (1 protein)
    this domain interrupts beta/alpha-barrel domain
    C-terminal domain is alpha/beta
  6. 2804065Protein Pyruvate kinase (PK) [50802] (6 species)
  7. 2804086Species Human (Homo sapiens) [TaxId:9606] [82151] (8 PDB entries)
  8. 2804112Domain d1lixc5: 1lix C:160-261 [302699]
    Other proteins in same PDB: d1lixa4, d1lixa6, d1lixb4, d1lixb5, d1lixc4, d1lixc6, d1lixd4, d1lixd6
    automated match to d2vgia1
    complexed with fbp, k, mn, pga; mutant

Details for d1lixc5

PDB Entry: 1lix (more details), 2.87 Å

PDB Description: Human erythrocyte pyruvate kinase: Arg486Trp mutant
PDB Compounds: (C:) Pyruvate kinase, isozymes R/L

SCOPe Domain Sequences for d1lixc5:

Sequence, based on SEQRES records: (download)

>d1lixc5 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgaqvdl

Sequence, based on observed residues (ATOM records): (download)

>d1lixc5 b.58.1.1 (C:160-261) Pyruvate kinase (PK) {Human (Homo sapiens) [TaxId: 9606]}
peirtgilqggpesevelvkgsqvlvtvdpafrtrgnantvwvdypnivrvvpvggriyi
ddglislvvqkigpeglvtqvenggvlgsrkgvnlpgadl

SCOPe Domain Coordinates for d1lixc5:

Click to download the PDB-style file with coordinates for d1lixc5.
(The format of our PDB-style files is described here.)

Timeline for d1lixc5: