Lineage for d1df9a_ (1df9 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794584Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2794585Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2798202Family b.47.1.0: automated matches [191364] (1 protein)
    not a true family
  6. 2798203Protein automated matches [190438] (36 species)
    not a true protein
  7. 2798211Species Dengue virus [TaxId:11064] [311128] (1 PDB entry)
  8. 2798212Domain d1df9a_: 1df9 A: [302326]
    Other proteins in same PDB: d1df9c_
    automated match to d3e90b_

Details for d1df9a_

PDB Entry: 1df9 (more details), 2.1 Å

PDB Description: dengue virus ns3-protease complexed with mung-bean bowman-birk inhibitor
PDB Compounds: (A:) nonstructural protein 1

SCOPe Domain Sequences for d1df9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1df9a_ b.47.1.0 (A:) automated matches {Dengue virus [TaxId: 11064]}
wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd

SCOPe Domain Coordinates for d1df9a_:

Click to download the PDB-style file with coordinates for d1df9a_.
(The format of our PDB-style files is described here.)

Timeline for d1df9a_: