PDB entry 1df9

View 1df9 on RCSB PDB site
Description: dengue virus ns3-protease complexed with mung-bean bowman-birk inhibitor
Class: Viral protein/Viral protein inhibitor
Keywords: BETA BARRELS, CATALYTIC TRIAD, INHIBITOR COMPLEX, MULTIPLE CONFORMATION, VIRUS/VIRAL PROTEIN/INHIBITOR, Viral protein-Viral protein inhibitor COMPLEX
Deposited on 1999-11-18, released 2000-08-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-04-04, with a file datestamp of 2012-03-30.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.199
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nonstructural protein 1
    Species: Dengue virus [TaxId:11064]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df9a_
  • Chain 'B':
    Compound: nonstructural protein 1
    Species: Dengue virus [TaxId:11064]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1df9b_
  • Chain 'C':
    Compound: Bowman-Birk type trypsin inhibitor
    Species: Vigna radiata var. radiata [TaxId:3916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01062 (0-71)
      • conflict (24)
    Domains in SCOPe 2.07: d1df9c_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1df9A (A:)
    hhhhhhagvlwdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtr
    gavlmhkgkriepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpg
    lfktnagtigavsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksied
    npeieddifrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df9A (A:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1df9B (B:)
    hhhhhhagvlwdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtr
    gavlmhkgkriepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpg
    lfktnagtigavsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksied
    npeieddifrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1df9B (B:)
    wdvpspppvgkaeledgayrikqkgilgysqigagvykegtfhtmwhvtrgavlmhkgkr
    iepswadvkkdlvscgggwklegewkegeevqvlalepgknpravqtkpglfktnagtig
    avsldfspgtsgspiidkkgkvvgiygngvvtrsgayvsaiaqteksiednpeiedd
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1df9C (C:)
    shdepsessepccdscdctksippqchcanirlnschsackscictrsmpgkcrcldtdd
    fcykpcesmdkd