SCOPe 2.06: Domain d5dfla1: 5dfl A:1-156

Lineage for d5dfla1 (5dfl A:1-156)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.20: UBC-like [54494] (1 superfamily)
   alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2

4. Superfamily d.20.1: UBC-like [54495] (5 families)

5. Family d.20.1.1: UBC-related [54496] (7 proteins)

6. Protein Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain [143063] (2 species)
   ubc1 homologue; also contains the C-terminal UBA domain

7. Species Human (Homo sapiens) [TaxId:9606] [143064] (7 PDB entries)
   Uniprot P61086 1-156

8. Domain d5dfla1: 5dfl A:1-156 [302049]
   Other proteins in same PDB: d5dfla2, d5dflb_
   automated match to d3e46a2
   complexed with gol

Details for d5dfla1

PDB Entry: 5dfl, 2.1 Å

PDB Description: crystal structure of ube2k~ubiquitin conjugate

PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d5dfla1:

Sequence; same for both SEQRES and ATOM records:

>d5dfla1 d.20.1.1 (A:1-156) Ubiquitin-conjugating enzyme E2-25 kDa, E2 domain {Human (Homo sapiens) [TaxId: 9606]}
aaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqlei
kipetypfnppkvrfitkiwhpnissvtgaikldilrdqwaaamtlrtvllslqallaaa
epddpqdavvanqykqnpemfkqtarlwahvyagap

Timeline for d5dfla1:

• d5dfla1 is new in SCOPe 2.06-stable
  
• d5dfla1 appears in SCOPe 2.07
  
• d5dfla1 appears in the current release, SCOPe 2.08