Lineage for d5dfla2 (5dfl A:157-199)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1985344Fold a.5: RuvA C-terminal domain-like [46928] (9 superfamilies)
    3 helices; bundle, right-handed twist
  4. 1985368Superfamily a.5.2: UBA-like [46934] (5 families) (S)
  5. 1985369Family a.5.2.1: UBA domain [46935] (25 proteins)
  6. 1985451Protein Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain [140327] (1 species)
  7. 1985452Species Human (Homo sapiens) [TaxId:9606] [140328] (7 PDB entries)
    Uniprot P61086 157-198
  8. 1985458Domain d5dfla2: 5dfl A:157-199 [302050]
    Other proteins in same PDB: d5dfla1, d5dflb_
    automated match to d1ylaa1
    complexed with gol

Details for d5dfla2

PDB Entry: 5dfl (more details), 2.1 Å

PDB Description: crystal structure of ube2k~ubiquitin conjugate
PDB Compounds: (A:) Ubiquitin-conjugating enzyme E2 K

SCOPe Domain Sequences for d5dfla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dfla2 a.5.2.1 (A:157-199) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
vsspeytkkienlsamgfdrnavivalsskswdvetatellls

SCOPe Domain Coordinates for d5dfla2:

Click to download the PDB-style file with coordinates for d5dfla2.
(The format of our PDB-style files is described here.)

Timeline for d5dfla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dfla1
View in 3D
Domains from other chains:
(mouse over for more information)
d5dflb_