SCOP 1.61: Domain d1hyhc1: 1hyh C:21-166

Lineage for d1hyhc1 (1hyh C:21-166)

Root: SCOP 1.61
Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families)
Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species)
Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry)
Domain d1hyhc1: 1hyh C:21-166 [30152]
Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2

Details for d1hyhc1

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits

SCOP Domain Sequences for d1hyhc1:

Sequence, based on SEQRES records: (download)

>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
isnpvdvitalfqhvtgfpahkvigt

Sequence, based on observed residues (ATOM records): (download)

>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
lfqhvtgfpahkvigt

SCOP Domain Coordinates for d1hyhc1:

Click to download the PDB-style file with coordinates for d1hyhc1.
(The format of our PDB-style files is described here.)

Timeline for d1hyhc1: