Lineage for d1hyhc1 (1hyh C:21-166)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093044Family c.2.1.5: LDH N-terminal domain-like [51848] (9 protein domains)
  6. 2093077Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species)
  7. 2093078Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry)
  8. 2093081Domain d1hyhc1: 1hyh C:21-166 [30152]
    Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2
    complexed with nad, so4

Details for d1hyhc1

PDB Entry: 1hyh (more details), 2.2 Å

PDB Description: crystal structure of l-2-hydroxyisocaproate dehydrogenase from lactobacillus confusus at 2.2 angstroms resolution-an example of strong asymmetry between subunits
PDB Compounds: (C:) l-2-hydroxyisocaproate dehydrogenase

SCOPe Domain Sequences for d1hyhc1:

Sequence, based on SEQRES records: (download)

>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv
isnpvdvitalfqhvtgfpahkvigt

Sequence, based on observed residues (ATOM records): (download)

>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]}
arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv
indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita
lfqhvtgfpahkvigt

SCOPe Domain Coordinates for d1hyhc1:

Click to download the PDB-style file with coordinates for d1hyhc1.
(The format of our PDB-style files is described here.)

Timeline for d1hyhc1: