Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
Protein L-2-hydroxyisocapronate dehydrogenase, L-HICDH [51857] (1 species) |
Species Lactobacillus confusus [TaxId:1583] [51858] (1 PDB entry) |
Domain d1hyhc1: 1hyh C:21-166 [30152] Other proteins in same PDB: d1hyha2, d1hyhb2, d1hyhc2, d1hyhd2 complexed with nad, so4 |
PDB Entry: 1hyh (more details), 2.2 Å
SCOPe Domain Sequences for d1hyhc1:
Sequence, based on SEQRES records: (download)
>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv indwaaladadvvistlgniklqqdnptgdrfaelkftssmvqsvgtnlkesgfhgvlvv isnpvdvitalfqhvtgfpahkvigt
>d1hyhc1 c.2.1.5 (C:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} arkigiiglgnvgaavahgliaqgvaddyvfidaneakvkadqidfqdamanleahgniv indwaaladadvvistlggdrfaelkftssmvqsvgtnlkesgfhgvlvvisnpvdvita lfqhvtgfpahkvigt
Timeline for d1hyhc1: