| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins) |
| Protein Malate dehydrogenase [51849] (13 species) |
| Species Aquaspirillum arcticum [TaxId:87645] [51856] (3 PDB entries) |
| Domain d1b8va1: 1b8v A:3-158 [30148] Other proteins in same PDB: d1b8va2 complexed with nad |
PDB Entry: 1b8v (more details), 2.1 Å
SCOPe Domain Sequences for d1b8va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1b8va1 c.2.1.5 (A:3-158) Malate dehydrogenase {Aquaspirillum arcticum [TaxId: 87645]}
ktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmeidd
cafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaidav
asrnikvlvvgnpantnayiamksapslpaknftam
Timeline for d1b8va1: