PDB entry 1b8v

View 1b8v on RCSB PDB site
Description: Malate dehydrogenase from Aquaspirillum arcticum
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase
Deposited on 1999-02-02, released 1999-07-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (malate dehydrogenase)
    Species: Aquaspirillum arcticum [TaxId:87645]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1b8va1, d1b8va2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1b8vA (A:)
    maktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmei
    ddcafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaid
    avasrnikvlvvgnpantnayiamksapslpaknftamlrldhnralsqiaaktgkpvss
    ieklfvwgnhsptmyadyryaqidgasvkdminddawnrdtflptvgkrgaaiidargvs
    saasaanaaidhihdwvlgtagkwttmgipsdgsygipegvifgfpvttengeykivqgl
    sidafsqerinvtlnelleeqngvqhllg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1b8vA (A:)
    ktpmrvavtgaagqicysllfriangdmlgkdqpvilqlleipnekaqkalqgvmmeidd
    cafpllagmtahadpmtafkdadvallvgarprgpgmerkdlleanaqiftvqgkaidav
    asrnikvlvvgnpantnayiamksapslpaknftamlrldhnralsqiaaktgkpvssie
    klfvwgnhsptmyadyryaqidgasvkdminddawnrdtflptvgkrgaaiidargvssa
    asaanaaidhihdwvlgtagkwttmgipsdgsygipegvifgfpvttengeykivqglsi
    dafsqerinvtlnelleeqngvqhllg