SCOPe 2.08: Domain d2hlpb1: 2hlp B:22-162

Lineage for d2hlpb1 (2hlp B:22-162)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein Malate dehydrogenase [51849] (13 species)

7. Species Haloarcula marismortui [TaxId:2238] [51855] (6 PDB entries)

8. Domain d2hlpb1: 2hlp B:22-162 [30142]
   Other proteins in same PDB: d2hlpa2, d2hlpb2
   complexed with cl, na; mutant

Details for d2hlpb1

PDB Entry: 2hlp, 2.59 Å

PDB Description: crystal structure of the e267r mutant of a halophilic malate dehydrogenase in the apo form

PDB Compounds: (B:) malate dehydrogenase

SCOPe Domain Sequences for d2hlpb1:

Sequence; same for both SEQRES and ATOM records:

>d2hlpb1 c.2.1.5 (B:22-162) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
tkvsvvgaagtvgaaagynialrdiadevvfvdipdkeddtvgqaadtnhgiaydsntrv
rqggyedtagsdvvvitagiprqpgqtridlagdnapimediqssldehnddyislttsn
pvdllnrhlyeagdrsreqvig

Timeline for d2hlpb1:

• d2hlpb1 first appeared (with stable ids) in SCOP 1.55
  
• d2hlpb1 appears in SCOPe 2.07