Lineage for d2hlpa2 (2hlp A:163-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2998746Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 2998747Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 2998748Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
    N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
    automatically mapped to Pfam PF02866
  6. 2999154Protein Malate dehydrogenase [56329] (12 species)
  7. 2999202Species Haloarcula marismortui [TaxId:2238] [56335] (6 PDB entries)
  8. 2999207Domain d2hlpa2: 2hlp A:163-330 [42108]
    Other proteins in same PDB: d2hlpa1, d2hlpb1
    complexed with cl, na; mutant

Details for d2hlpa2

PDB Entry: 2hlp (more details), 2.59 Å

PDB Description: crystal structure of the e267r mutant of a halophilic malate dehydrogenase in the apo form
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d2hlpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hlpa2 d.162.1.1 (A:163-330) Malate dehydrogenase {Haloarcula marismortui [TaxId: 2238]}
fggrldsarfryvlseefdapvqnvegtilgehgdaqvpvfskvrvdgtdpefsgdekeq
llgdlqesamdvierkgatewgpargvahmveailhdtgrvlpasvklegefghedtafg
vpvrlgsngveeivewdlddyeqdlmadaaeklsdqydkis

SCOPe Domain Coordinates for d2hlpa2:

Click to download the PDB-style file with coordinates for d2hlpa2.
(The format of our PDB-style files is described here.)

Timeline for d2hlpa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hlpa1