Lineage for d1civa1 (1civ A:12-193)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118791Species Flaveria bidentis, chloroplast [TaxId:4224] [51852] (1 PDB entry)
  8. 118792Domain d1civa1: 1civ A:12-193 [30134]
    Other proteins in same PDB: d1civa2

Details for d1civa1

PDB Entry: 1civ (more details), 2.8 Å

PDB Description: chloroplast nadp-dependent malate dehydrogenase from flaveria bidentis

SCOP Domain Sequences for d1civa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1civa1 c.2.1.5 (A:12-193) Malate dehydrogenase {Flaveria bidentis, chloroplast}
lpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllfklasgevfgpd
qpislkllgsersfaalegvameledslypllrqvsigidpyeifqdaewalligakprg
pgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclknapnippknfh
al

SCOP Domain Coordinates for d1civa1:

Click to download the PDB-style file with coordinates for d1civa1.
(The format of our PDB-style files is described here.)

Timeline for d1civa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1civa2