Lineage for d1civa1 (1civ A:12-193)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (8 families) 
Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (3 proteins) 
Protein Malate dehydrogenase [51849] (7 species) 
Species Flaveria bidentis, chloroplast [TaxId:4224] [51852] (1 PDB entry) 
Domain d1civa1: 1civ A:12-193 [30134]
Other proteins in same PDB: d1civa2
Details for d1civa1
PDB Entry: 1civ (more details), 2.8 Å
PDB Description: chloroplast nadp-dependent malate dehydrogenase from flaveria bidentis
SCOP Domain Sequences for d1civa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1civa1 c.2.1.5 (A:12-193) Malate dehydrogenase {Flaveria bidentis, chloroplast}
lpakqkpecfgvfcltydlkaeeetkswkkiinvavsgaagmisnhllfklasgevfgpd
qpislkllgsersfaalegvameledslypllrqvsigidpyeifqdaewalligakprg
pgmeradlldingqifaeqgkalnavaspnvkvmvvgnpcntnaliclknapnippknfh
al
SCOP Domain Coordinates for d1civa1:
Click to download the PDB-style file with coordinates for d1civa1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1civa1:
- d1civa1 appears in SCOP 1.57
- d1civa1 appears in the current release, SCOPe 2.08
View in 3D
