Lineage for d1mldc1 (1mld C:1-144)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 117972Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
  4. 117973Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 118692Family c.2.1.5: Lactate & malate dehydrogenases, N-terminal domain [51848] (4 proteins)
  6. 118753Protein Malate dehydrogenase [51849] (10 species)
  7. 118793Species Pig (Sus scrofa) [TaxId:9823] [51850] (3 PDB entries)
  8. 118796Domain d1mldc1: 1mld C:1-144 [30124]
    Other proteins in same PDB: d1mlda2, d1mldb2, d1mldc2, d1mldd2

Details for d1mldc1

PDB Entry: 1mld (more details), 1.9 Å

PDB Description: refined structure of mitochondrial malate dehydrogenase from porcine heart and the consensus structure for dicarboxylic acid oxidoreductases

SCOP Domain Sequences for d1mldc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mldc1 c.2.1.5 (C:1-144) Malate dehydrogenase {Pig (Sus scrofa)}
akvavlgasggigqplslllknsplvsrltlydiahtpgvaadlshietratvkgylgpe
qlpdclkgcdvvvipagvprkpgmtrddlfntnativatltaacaqhcpdamiciisnpv
nstipitaevfkkhgvynpnkifg

SCOP Domain Coordinates for d1mldc1:

Click to download the PDB-style file with coordinates for d1mldc1.
(The format of our PDB-style files is described here.)

Timeline for d1mldc1: