Lineage for d1ofgc1 (1ofg C:1-160,C:323-381)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 238223Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 238224Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (10 families) (S)
  5. 238741Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (12 proteins)
    family members also share a common alpha+beta fold in C-terminal domain
  6. 238804Protein Glucose-fructose oxidoreductase, N-terminal domain [51825] (1 species)
  7. 238805Species Zymomonas mobilis [TaxId:542] [51826] (6 PDB entries)
  8. 238826Domain d1ofgc1: 1ofg C:1-160,C:323-381 [30066]
    Other proteins in same PDB: d1ofga2, d1ofgb2, d1ofgc2, d1ofgd2, d1ofge2, d1ofgf2

Details for d1ofgc1

PDB Entry: 1ofg (more details), 2.7 Å

PDB Description: glucose-fructose oxidoreductase

SCOP Domain Sequences for d1ofgc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ofgc1 c.2.1.3 (C:1-160,C:323-381) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis}
atlpagasqvpttpagrpmpyairpmpedrrfgyaivglgkyalnqilpgfagcqhsrie
alvsgnaekakivaaeygvdprkiydysnfdkiakdpkidavyiilpnslhaefairafk
agkhvmcekpmatsvadcqrmidaakaankklmigyrchyXnqfsaqldhlaeavinnkp
vrspgeegmqdvrliqaiyeaartgrpvntdwgyvrqggy

SCOP Domain Coordinates for d1ofgc1:

Click to download the PDB-style file with coordinates for d1ofgc1.
(The format of our PDB-style files is described here.)

Timeline for d1ofgc1: