SCOPe 2.08: Domain d4rf1a1: 4rf1 A:1483-1542

Lineage for d4rf1a1 (4rf1 A:1483-1542)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311426] (3 PDB entries)

8. Domain d4rf1a1: 4rf1 A:1483-1542 [300658]
   Other proteins in same PDB: d4rf1a2, d4rf1b_
   automated match to d4p16a1
   complexed with 3cn, pgo, zn

Details for d4rf1a1

PDB Entry: 4rf1, 2.15 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P63)

PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4rf1a1:

Sequence; same for both SEQRES and ATOM records:

>d4rf1a1 d.15.1.0 (A:1483-1542) automated matches {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
ltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnlt

Timeline for d4rf1a1:

• d4rf1a1 first appeared in SCOPe 2.06
  
• d4rf1a1 appears in SCOPe 2.07