Lineage for d4rf1a2 (4rf1 A:1543-1803)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2154577Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2154578Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2155396Family d.3.1.23: Papain-like viral protease catalytic domain [310648] (2 protein domains)
    C-terminal part of Pfam PF08715
  6. 2155397Protein Papain-like protease PLpro, catalytic domain [310795] (3 species)
  7. 2155402Species Human betacoronavirus 2c jordan-n3/2012 [TaxId:1306931] [311427] (5 PDB entries)
  8. 2155403Domain d4rf1a2: 4rf1 A:1543-1803 [300659]
    Other proteins in same PDB: d4rf1a1, d4rf1b_
    automated match to d4p16a2
    complexed with 3cn, pgo, zn

Details for d4rf1a2

PDB Entry: 4rf1 (more details), 2.15 Å

PDB Description: Crystal structure of the Middle-East respiratory syndrome coronavirus papain-like protease in complex with ubiquitin (space group P63)
PDB Compounds: (A:) ORF1ab protein

SCOPe Domain Sequences for d4rf1a2:

Sequence, based on SEQRES records: (download)

>d4rf1a2 d.3.1.23 (A:1543-1803) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlkgglilkfdsgtvskts
dwkckvtdvlfpgqkyssdcn

Sequence, based on observed residues (ATOM records): (download)

>d4rf1a2 d.3.1.23 (A:1543-1803) Papain-like protease PLpro, catalytic domain {Human betacoronavirus 2c jordan-n3/2012 [TaxId: 1306931]}
adetkalkelygpvdptflhrfyslkaavhgwkmvvcdkvrslklsdnncylnavimtld
llkdikfvipalqhafmkhkggdstdfialimaygnctfgapddasrllhtvlakaelcc
sarmvwrewcnvcgikdvvlqglkaccyvgvqtvedlrarmtyvcqcggerhrqlvehtt
pwlllsgtpneklvttstapdfvafnvfqgietavghyvharlklilkfdsgtvsktsdw
kckvtdvlfpgqkyssdcn

SCOPe Domain Coordinates for d4rf1a2:

Click to download the PDB-style file with coordinates for d4rf1a2.
(The format of our PDB-style files is described here.)

Timeline for d4rf1a2:

  • d4rf1a2 is new in SCOPe 2.06-stable

View in 3D
Domains from same chain:
(mouse over for more information)
d4rf1a1
View in 3D
Domains from other chains:
(mouse over for more information)
d4rf1b_