Lineage for d4p16a1 (4p16 A:1-61)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
Superfamily d.15.1: Ubiquitin-like [54236] (11 families) 
Family d.15.1.9: Viral protease ubiquitin-like domain [310647] (1 protein)
N-terminal part of Pfam PF08715Protein Papain-like protease PLpro, ubiquitin-like domain [310794] (2 species) 
Species Human betacoronavirus 2c EMC/2012 [TaxId:1235996] [311053] (1 PDB entry) 
Domain d4p16a1: 4p16 A:1-61 [307967]
Other proteins in same PDB: d4p16a2
complexed with zn
Details for d4p16a1
PDB Entry: 4p16 (more details), 2.5 Å
PDB Description: crystal structure of the papain-like protease of middle-east respiratory syndrome coronavirus
PDB Compounds: (A:) ORF1aSCOPe Domain Sequences for d4p16a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4p16a1 d.15.1.9 (A:1-61) Papain-like protease PLpro, ubiquitin-like domain {Human betacoronavirus 2c EMC/2012 [TaxId: 1235996]}
qltievlvtvdgvnfrtvvlnnkntyrsqlgcvffngadisdtipdekqnghslyladnl
t
SCOPe Domain Coordinates for d4p16a1:
Click to download the PDB-style file with coordinates for d4p16a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4p16a1:
- d4p16a1 first appeared in SCOPe 2.06
- d4p16a1 appears in SCOPe 2.07
View in 3D
