SCOPe 2.08: Domain d1gcua1: 1gcu A:1-128,A:247-292

Lineage for d1gcua1 (1gcu A:1-128,A:247-292)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins)
   family members also share a common alpha+beta fold in C-terminal domain

6. Protein Biliverdin reductase [51823] (1 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [51824] (3 PDB entries)

8. Domain d1gcua1: 1gcu A:1-128,A:247-292 [30063]
   Other proteins in same PDB: d1gcua2

Details for d1gcua1

PDB Entry: 1gcu, 1.4 Å

PDB Description: crystal structure of rat biliverdin reductase at 1.4 a

PDB Compounds: (A:) biliverdin reductase a

SCOPe Domain Sequences for d1gcua1:

Sequence; same for both SEQRES and ATOM records:

>d1gcua1 c.2.1.3 (A:1-128,A:247-292) Biliverdin reductase {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mdaepkrkfgvvvvgvgragsvrlrdlkdprsaaflnligfvsrrelgsldevrqisled
alrsqeidvayicsessshedyirqflqagkhvlveypmtlsfaaaqelwelaaqkgrvl
heehvellXkniflkdqdifvqklldqvsaedlaaekkrimhclglasdiqklch

Timeline for d1gcua1:

• d1gcua1 first appeared (with stable ids) in SCOP 1.55
  
• d1gcua1 appears in SCOPe 2.07