SCOPe 2.08: Domain d4o4lf1: 4o4l F:1-76

Lineage for d4o4lf1 (4o4l F:1-76)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (40 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [311405] (6 PDB entries)

8. Domain d4o4lf1: 4o4l F:1-76 [299943]
   Other proteins in same PDB: d4o4la1, d4o4la2, d4o4lb1, d4o4lb2, d4o4lc1, d4o4lc2, d4o4ld1, d4o4ld2, d4o4le_, d4o4lf2
   automated match to d3tiia1
   complexed with ca, ep, gdp, gtp, mes, mg, pou

Details for d4o4lf1

PDB Entry: 4o4l, 2.2 Å

PDB Description: Tubulin-Peloruside A-Epothilone A complex

PDB Compounds: (F:) Tubulin-tyrosine ligase

SCOPe Domain Sequences for d4o4lf1:

Sequence; same for both SEQRES and ATOM records:

>d4o4lf1 c.30.1.0 (F:1-76) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mytfvvrdenssvyaevsrlllatgqwkrlrkdnprfnlmlgernrlpfgrlghepglvq
lvnyyrgadklcrkas

Timeline for d4o4lf1:

• d4o4lf1 first appeared in SCOPe 2.06
  
• d4o4lf1 appears in SCOPe 2.07